PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr017914.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family NAC
Protein Properties Length: 373aa    MW: 41856.9 Da    PI: 6.8947
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr017914.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM156.79.8e-4911291128
          NAM   1 lppGfrFhPtdeelvveyLkkkvegkk.leleevikevdiykvePwdLp.kkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskk 96 
                  + pGfrF+Ptdeel+++yLk+k+eg    +  evi+evdi+++ePwdLp k+v ++e+ew+fFs+r +ky++g++++rat+ gyWkatgk+++v+s +
  Pbr017914.1   1 MFPGFRFSPTDEELISYYLKNKLEGPVpGKGVEVISEVDICNFEPWDLPaKSVIQSENEWFFFSPRGRKYPNGSQSRRATEFGYWKATGKERNVKS-S 97 
                  579*********************9885444588***************667777899**************************************.9 PP

          NAM  97 gelvglkktLvfykgrapkgektdWvmheyrl 128
                  ++ +g+k+tLvf+ grapkge+t+W+mhey +
  Pbr017914.1  98 SNIIGTKRTLVFHIGRAPKGERTEWIMHEYCI 129
                  99****************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5100553.8951145IPR003441NAC domain
SuperFamilySSF1019413.53E-532144IPR003441NAC domain
PfamPF023651.9E-253128IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009845Biological Processseed germination
GO:0009938Biological Processnegative regulation of gibberellic acid mediated signaling pathway
GO:0033619Biological Processmembrane protein proteolysis
GO:0048573Biological Processphotoperiodism, flowering
GO:0071472Biological Processcellular response to salt stress
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 373 aa     Download sequence    Send to blast
MFPGFRFSPT DEELISYYLK NKLEGPVPGK GVEVISEVDI CNFEPWDLPA KSVIQSENEW  60
FFFSPRGRKY PNGSQSRRAT EFGYWKATGK ERNVKSSSNI IGTKRTLVFH IGRAPKGERT  120
EWIMHEYCIN DKPQDSMVVC RLRKNSEFCL NDTTNQGCSS RTPLSTMQND GNAVSEIGND  180
QGDKAVECNS KKSTSSHDSH SIEQIDSASD SYPKPVTDAT QTDSNGHQKG SYDEDLYAEI  240
LNDDIIKLDE SSVPAAHMMP VVANNSDAEH QSQQHMQATL SQAVPFQGTA NRRIHLRKRK  300
EKFCAESQKS STSEQSRKAL VNWMDDRLML LYVFFVFLVL LAVFLSNFCF PDVAGSVSAR  360
VGKILASQKH HM*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-41314217165Stress-induced transcription factor NAC1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1296301RKRKEK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00280DAPTransfer from AT2G27300Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMap-Retrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009374965.10.0PREDICTED: NAC domain-containing protein 89-like
SwissprotQ9XIN79e-87NAC40_ARATH; NAC domain-containing protein 40
TrEMBLM5WBR11e-148M5WBR1_PRUPE; Uncharacterized protein
STRINGGLYMA13G39090.21e-127(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73153346
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G27300.17e-87NTM1-like 8